RBMS1,C2orf12
  • RBMS1,C2orf12

Anti-RBMS1 Antibody 100ul

Ref: AN-HPA061791-100ul
Anti-RBMS1

Información del producto

Polyclonal Antibody against Human RBMS1, Gene description: RNA binding motif, single stranded interacting protein 1, Alternative Gene Names: C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1, Validated applications: ICC, WB, Uniprot ID: P29558, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBMS1
Gene Description RNA binding motif, single stranded interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP
Immunogen QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P29558
HTS Code 3002150000
Gene ID 5937
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBMS1 Antibody 100ul

Anti-RBMS1 Antibody 100ul