RPRD2,FLJ32145
  • RPRD2,FLJ32145

Anti-RPRD2 Antibody 25ul

Ref: AN-HPA061693-25ul
Anti-RPRD2

Información del producto

Polyclonal Antibody against Human RPRD2, Gene description: regulation of nuclear pre-mRNA domain containing 2, Alternative Gene Names: FLJ32145, HSPC099, KIAA0460, Validated applications: ICC, IHC, Uniprot ID: Q5VT52, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RPRD2
Gene Description regulation of nuclear pre-mRNA domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
Immunogen PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32145, HSPC099, KIAA0460
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VT52
HTS Code 3002150000
Gene ID 23248
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPRD2 Antibody 25ul

Anti-RPRD2 Antibody 25ul