NIF3L1,ALS2CR1
  • NIF3L1,ALS2CR1

Anti-NIF3L1 Antibody 100ul

Ref: AN-HPA061466-100ul
Anti-NIF3L1

Información del producto

Polyclonal Antibody against Human NIF3L1, Gene description: NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae), Alternative Gene Names: ALS2CR1, CALS-7, MDS015, Validated applications: IHC, Uniprot ID: Q9GZT8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NIF3L1
Gene Description NIF3 NGG1 interacting factor 3-like 1 (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE
Immunogen IYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALS2CR1, CALS-7, MDS015
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZT8
HTS Code 3002150000
Gene ID 60491
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NIF3L1 Antibody 100ul

Anti-NIF3L1 Antibody 100ul