CLEC16A,Gop-1
  • CLEC16A,Gop-1

Anti-CLEC16A Antibody 25ul

Ref: AN-HPA061385-25ul
Anti-CLEC16A

Información del producto

Polyclonal Antibody against Human CLEC16A, Gene description: C-type lectin domain family 16, member A, Alternative Gene Names: Gop-1, KIAA0350, Validated applications: ICC, WB, Uniprot ID: Q2KHT3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLEC16A
Gene Description C-type lectin domain family 16, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP
Immunogen EPETQLPLTREEDLIKTDDVLDLNNSDLIACTVITKDGGMVQRFLAVDIYQMSLVEPDVSRLGWGVVKFAGLLQDMQVTGVEDDSRALNITIHKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Gop-1, KIAA0350
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2KHT3
HTS Code 3002150000
Gene ID 23274
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLEC16A Antibody 25ul

Anti-CLEC16A Antibody 25ul