NFX1,MGC20369,NFX2
  • NFX1,MGC20369,NFX2

Anti-NFX1 Antibody 100ul

Ref: AN-HPA061382-100ul
Anti-NFX1

Información del producto

Polyclonal Antibody against Human NFX1, Gene description: nuclear transcription factor, X-box binding 1, Alternative Gene Names: MGC20369, NFX2, TEG-42, Tex42, Validated applications: ICC, Uniprot ID: Q12986, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NFX1
Gene Description nuclear transcription factor, X-box binding 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR
Immunogen VFHPDSSEASSRKGVLDGYGARRNEQRRYPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENLAVINKSSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC20369, NFX2, TEG-42, Tex42
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12986
HTS Code 3002150000
Gene ID 4799
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NFX1 Antibody 100ul

Anti-NFX1 Antibody 100ul