GTF3C6,bA397G5.3
  • GTF3C6,bA397G5.3

Anti-GTF3C6 Antibody 25ul

Ref: AN-HPA061345-25ul
Anti-GTF3C6

Información del producto

Polyclonal Antibody against Human GTF3C6, Gene description: general transcription factor IIIC, polypeptide 6, alpha 35kDa, Alternative Gene Names: bA397G5.3, C6orf51, TFIIIC35, Validated applications: ICC, IHC, Uniprot ID: Q969F1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GTF3C6
Gene Description general transcription factor IIIC, polypeptide 6, alpha 35kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Immunogen DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA397G5.3, C6orf51, TFIIIC35
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969F1
HTS Code 3002150000
Gene ID 112495
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTF3C6 Antibody 25ul

Anti-GTF3C6 Antibody 25ul