POLR3D,BN51T,RPC4
  • POLR3D,BN51T,RPC4

Anti-POLR3D Antibody 25ul

Ref: AN-HPA061331-25ul
Anti-POLR3D

Información del producto

Polyclonal Antibody against Human POLR3D, Gene description: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa, Alternative Gene Names: BN51T, RPC4, TSBN51, Validated applications: ICC, WB, Uniprot ID: P05423, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POLR3D
Gene Description polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Immunogen DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BN51T, RPC4, TSBN51
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P05423
HTS Code 3002150000
Gene ID 661
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POLR3D Antibody 25ul

Anti-POLR3D Antibody 25ul