CENPI,CENP-I
  • CENPI,CENP-I

Anti-CENPI Antibody 100ul

Ref: AN-HPA061297-100ul
Anti-CENPI

Información del producto

Polyclonal Antibody against Human CENPI, Gene description: centromere protein I, Alternative Gene Names: CENP-I, FSHPRH1, LRPR1, Mis6, Validated applications: ICC, Uniprot ID: Q92674, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPI
Gene Description centromere protein I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
Immunogen PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-I, FSHPRH1, LRPR1, Mis6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92674
HTS Code 3002150000
Gene ID 2491
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPI Antibody 100ul

Anti-CENPI Antibody 100ul