PPP1R1B,DARPP-32
  • PPP1R1B,DARPP-32

Anti-PPP1R1B Antibody 25ul

Ref: AN-HPA061142-25ul
Anti-PPP1R1B

Información del producto

Polyclonal Antibody against Human PPP1R1B, Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 1B, Alternative Gene Names: DARPP-32, FLJ20940, Validated applications: IHC, Uniprot ID: Q9UD71, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPP1R1B
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Immunogen EEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DARPP-32, FLJ20940
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UD71
HTS Code 3002150000
Gene ID 84152
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPP1R1B Antibody 25ul

Anti-PPP1R1B Antibody 25ul