SUGP2,KIAA0365
  • SUGP2,KIAA0365

Anti-SUGP2 Antibody 100ul

Ref: AN-HPA061111-100ul
Anti-SUGP2

Información del producto

Polyclonal Antibody against Human SUGP2, Gene description: SURP and G patch domain containing 2, Alternative Gene Names: KIAA0365, SFRS14, Validated applications: ICC, IHC, Uniprot ID: Q8IX01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SUGP2
Gene Description SURP and G patch domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG
Immunogen ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0365, SFRS14
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IX01
HTS Code 3002150000
Gene ID 10147
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SUGP2 Antibody 100ul

Anti-SUGP2 Antibody 100ul