AP1S1,AP19,CLAPS1
  • AP1S1,AP19,CLAPS1

Anti-AP1S1 Antibody 100ul

Ref: AN-HPA060945-100ul
Anti-AP1S1

Información del producto

Polyclonal Antibody against Human AP1S1, Gene description: adaptor-related protein complex 1, sigma 1 subunit, Alternative Gene Names: AP19, CLAPS1, EKV3, SIGMA1A, WUGSC:H_DJ0747G18.2, Validated applications: ICC, WB, Uniprot ID: P61966, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AP1S1
Gene Description adaptor-related protein complex 1, sigma 1 subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Immunogen KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AP19, CLAPS1, EKV3, SIGMA1A, WUGSC:H_DJ0747G18.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P61966
HTS Code 3002150000
Gene ID 1174
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AP1S1 Antibody 100ul

Anti-AP1S1 Antibody 100ul