BORCS6,C17orf59
  • BORCS6,C17orf59

Anti-BORCS6 Antibody 100ul

Ref: AN-HPA060791-100ul
Anti-BORCS6

Información del producto

Polyclonal Antibody against Human BORCS6, Gene description: BLOC-1 related complex subunit 6, Alternative Gene Names: C17orf59, FLJ20014, Validated applications: ICC, WB, Uniprot ID: Q96GS4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BORCS6
Gene Description BLOC-1 related complex subunit 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS
Immunogen PETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVVHRPEREALENEPGPQGTLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C17orf59, FLJ20014
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GS4
HTS Code 3002150000
Gene ID 54785
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BORCS6 Antibody 100ul

Anti-BORCS6 Antibody 100ul