YJEFN3,FLJ44968
  • YJEFN3,FLJ44968

Anti-YJEFN3 Antibody 100ul

Ref: AN-HPA060789-100ul
Anti-YJEFN3

Información del producto

Polyclonal Antibody against Human YJEFN3, Gene description: YjeF N-terminal domain containing 3, Alternative Gene Names: FLJ44968, hYjeF_N3-19p13.11, Validated applications: ICC, IHC, Uniprot ID: A6XGL0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name YJEFN3
Gene Description YjeF N-terminal domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD
Immunogen SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ44968, hYjeF_N3-19p13.11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A6XGL0
HTS Code 3002150000
Gene ID 374887
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-YJEFN3 Antibody 100ul

Anti-YJEFN3 Antibody 100ul