SOX5,L-SOX5,MGC35153
  • SOX5,L-SOX5,MGC35153

Anti-SOX5 Antibody 100ul

Ref: AN-HPA060499-100ul
Anti-SOX5

Información del producto

Polyclonal Antibody against Human SOX5, Gene description: SRY (sex determining region Y)-box 5, Alternative Gene Names: L-SOX5, MGC35153, Validated applications: ICC, Uniprot ID: P35711, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SOX5
Gene Description SRY (sex determining region Y)-box 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALG
Immunogen VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names L-SOX5, MGC35153
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35711
HTS Code 3002150000
Gene ID 6660
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SOX5 Antibody 100ul

Anti-SOX5 Antibody 100ul