CENPJ,BM032,CPAP
  • CENPJ,BM032,CPAP

Anti-CENPJ Antibody 100ul

Ref: AN-HPA060426-100ul
Anti-CENPJ

Información del producto

Polyclonal Antibody against Human CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Validated applications: ICC, Uniprot ID: Q9HC77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPJ
Gene Description centromere protein J
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVK
Immunogen DRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKRKIAPVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HC77
HTS Code 3002150000
Gene ID 55835
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPJ Antibody 100ul

Anti-CENPJ Antibody 100ul