ALG1,HMAT1,HMT-1
  • ALG1,HMAT1,HMT-1

Anti-ALG1 Antibody 100ul

Ref: AN-HPA060392-100ul
Anti-ALG1

Información del producto

Polyclonal Antibody against Human ALG1, Gene description: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase, Alternative Gene Names: HMAT1, HMT-1, Validated applications: ICC, IHC, Uniprot ID: Q9BT22, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ALG1
Gene Description ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Immunogen NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HMAT1, HMT-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BT22
HTS Code 3002150000
Gene ID 56052
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ALG1 Antibody 100ul

Anti-ALG1 Antibody 100ul