SENP3,DKFZP586K0919
  • SENP3,DKFZP586K0919

Anti-SENP3 Antibody 100ul

Ref: AN-HPA060290-100ul
Anti-SENP3

Información del producto

Polyclonal Antibody against Human SENP3, Gene description: SUMO1/sentrin/SMT3 specific peptidase 3, Alternative Gene Names: DKFZP586K0919, DKFZp762A152, SMT3IP1, SSP3, Ulp1, Validated applications: ICC, IHC, Uniprot ID: Q9H4L4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SENP3
Gene Description SUMO1/sentrin/SMT3 specific peptidase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL
Immunogen LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586K0919, DKFZp762A152, SMT3IP1, SSP3, Ulp1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4L4
HTS Code 3002150000
Gene ID 26168
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SENP3 Antibody 100ul

Anti-SENP3 Antibody 100ul