TPRG1,FAM79B
  • TPRG1,FAM79B

Anti-TPRG1 Antibody 100ul

Ref: AN-HPA060187-100ul
Anti-TPRG1

Información del producto

Polyclonal Antibody against Human TPRG1, Gene description: tumor protein p63 regulated 1, Alternative Gene Names: FAM79B, FLJ41238, FLJ43694, Validated applications: ICC, IHC, Uniprot ID: Q6ZUI0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TPRG1
Gene Description tumor protein p63 regulated 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
Immunogen TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM79B, FLJ41238, FLJ43694
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZUI0
HTS Code 3002150000
Gene ID 285386
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TPRG1 Antibody 100ul

Anti-TPRG1 Antibody 100ul