HOXA4,HOX1,HOX1D
  • HOXA4,HOX1,HOX1D

Anti-HOXA4 Antibody 100ul

Ref: AN-HPA060088-100ul
Anti-HOXA4

Información del producto

Polyclonal Antibody against Human HOXA4, Gene description: homeobox A4, Alternative Gene Names: HOX1, HOX1D, Validated applications: ICC, IHC, WB, Uniprot ID: Q00056, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HOXA4
Gene Description homeobox A4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Immunogen NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HOX1, HOX1D
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00056
HTS Code 3002150000
Gene ID 3201
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HOXA4 Antibody 100ul

Anti-HOXA4 Antibody 100ul