EHMT1,bA188C12.1
  • EHMT1,bA188C12.1

Anti-EHMT1 Antibody 100ul

Ref: AN-HPA060022-100ul
Anti-EHMT1

Información del producto

Polyclonal Antibody against Human EHMT1, Gene description: euchromatic histone-lysine N-methyltransferase 1, Alternative Gene Names: bA188C12.1, Eu-HMTase1, FLJ12879, KIAA1876, KMT1D, Validated applications: ICC, Uniprot ID: Q9H9B1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EHMT1
Gene Description euchromatic histone-lysine N-methyltransferase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence ADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATL
Immunogen ADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA188C12.1, Eu-HMTase1, FLJ12879, KIAA1876, KMT1D
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H9B1
HTS Code 3002150000
Gene ID 79813
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EHMT1 Antibody 100ul

Anti-EHMT1 Antibody 100ul