FAM122C,RP3-473B4.1
  • FAM122C,RP3-473B4.1

Anti-FAM122C Antibody 25ul

Ref: AN-HPA059961-25ul
Anti-FAM122C

Información del producto

Polyclonal Antibody against Human FAM122C, Gene description: family with sequence similarity 122C, Alternative Gene Names: RP3-473B4.1, Validated applications: IHC, Uniprot ID: Q6P4D5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM122C
Gene Description family with sequence similarity 122C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLH
Immunogen PLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPFHGSISRLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RP3-473B4.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P4D5
HTS Code 3002150000
Gene ID 159091
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FAM122C Antibody 25ul

Anti-FAM122C Antibody 25ul