IFIT3,CIG-49
  • IFIT3,CIG-49

Anti-IFIT3 Antibody 25ul

Ref: AN-HPA059914-25ul
Anti-IFIT3

Información del producto

Polyclonal Antibody against Human IFIT3, Gene description: interferon-induced protein with tetratricopeptide repeats 3, Alternative Gene Names: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G, Validated applications: ICC, IHC, WB, Uniprot ID: O14879, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFIT3
Gene Description interferon-induced protein with tetratricopeptide repeats 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
Immunogen HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14879
HTS Code 3002150000
Gene ID 3437
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFIT3 Antibody 25ul

Anti-IFIT3 Antibody 25ul