NEURL2,C20orf163
  • NEURL2,C20orf163

Anti-NEURL2 Antibody 25ul

Ref: AN-HPA059842-25ul
Anti-NEURL2

Información del producto

Polyclonal Antibody against Human NEURL2, Gene description: neuralized E3 ubiquitin protein ligase 2, Alternative Gene Names: C20orf163, dJ337O18.6, FLJ30259, Ozz, Ozz-E3, Validated applications: ICC, Uniprot ID: Q9BR09, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NEURL2
Gene Description neuralized E3 ubiquitin protein ligase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL
Immunogen YELNVLPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf163, dJ337O18.6, FLJ30259, Ozz, Ozz-E3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BR09
HTS Code 3002150000
Gene ID 140825
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NEURL2 Antibody 25ul

Anti-NEURL2 Antibody 25ul