CAPNS2,MGC12536
  • CAPNS2,MGC12536

Anti-CAPNS2 Antibody 25ul

Ref: AN-HPA059749-25ul
Anti-CAPNS2

Información del producto

Polyclonal Antibody against Human CAPNS2, Gene description: calpain small subunit 2, Alternative Gene Names: MGC12536, MGC14804, Validated applications: ICC, Uniprot ID: Q96L46, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CAPNS2
Gene Description calpain small subunit 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Immunogen KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC12536, MGC14804
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96L46
HTS Code 3002150000
Gene ID 84290
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CAPNS2 Antibody 25ul

Anti-CAPNS2 Antibody 25ul