PLA1A,ps-PLA1
  • PLA1A,ps-PLA1

Anti-PLA1A Antibody 25ul

Ref: AN-HPA059740-25ul
Anti-PLA1A

Información del producto

Polyclonal Antibody against Human PLA1A, Gene description: phospholipase A1 member A, Alternative Gene Names: ps-PLA1, Validated applications: ICC, Uniprot ID: Q53H76, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLA1A
Gene Description phospholipase A1 member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
Immunogen QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ps-PLA1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53H76
HTS Code 3002150000
Gene ID 51365
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLA1A Antibody 25ul

Anti-PLA1A Antibody 25ul