C19orf54,FLJ41131
  • C19orf54,FLJ41131

Anti-C19orf54 Antibody 100ul

Ref: AN-HPA059628-100ul
Anti-C19orf54

Información del producto

Polyclonal Antibody against Human C19orf54, Gene description: chromosome 19 open reading frame 54, Alternative Gene Names: FLJ41131, Validated applications: IHC, Uniprot ID: Q5BKX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C19orf54
Gene Description chromosome 19 open reading frame 54
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
Immunogen HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ41131
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5BKX5
HTS Code 3002150000
Gene ID 284325
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C19orf54 Antibody 100ul

Anti-C19orf54 Antibody 100ul