SERPINB10,bomapin
  • SERPINB10,bomapin

Anti-SERPINB10 Antibody 25ul

Ref: AN-HPA059582-25ul
Anti-SERPINB10

Información del producto

Polyclonal Antibody against Human SERPINB10, Gene description: serpin peptidase inhibitor, clade B (ovalbumin), member 10, Alternative Gene Names: bomapin, PI10, Validated applications: IHC, Uniprot ID: P48595, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SERPINB10
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK
Immunogen INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bomapin, PI10
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P48595
HTS Code 3002150000
Gene ID 5273
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SERPINB10 Antibody 25ul

Anti-SERPINB10 Antibody 25ul