TSN,BCLF-1,REHF-1
  • TSN,BCLF-1,REHF-1

Anti-TSN Antibody 100ul

Ref: AN-HPA059561-100ul
Anti-TSN

Información del producto

Polyclonal Antibody against Human TSN, Gene description: translin, Alternative Gene Names: BCLF-1, REHF-1, TRSLN, Validated applications: IHC, WB, Uniprot ID: Q15631, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSN
Gene Description translin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
Immunogen MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCLF-1, REHF-1, TRSLN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15631
HTS Code 3002150000
Gene ID 7247
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSN Antibody 100ul

Anti-TSN Antibody 100ul