ATG9A,APG9L1
  • ATG9A,APG9L1

Anti-ATG9A Antibody 25ul

Ref: AN-HPA059551-25ul
Anti-ATG9A

Información del producto

Polyclonal Antibody against Human ATG9A, Gene description: autophagy related 9A, Alternative Gene Names: APG9L1, FLJ22169, Validated applications: ICC, IHC, Uniprot ID: Q7Z3C6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ATG9A
Gene Description autophagy related 9A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Immunogen IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APG9L1, FLJ22169
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z3C6
HTS Code 3002150000
Gene ID 79065
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATG9A Antibody 25ul

Anti-ATG9A Antibody 25ul