NDUFA10,CI-42k
  • NDUFA10,CI-42k

Anti-NDUFA10 Antibody 100ul

Ref: AN-HPA059529-100ul
Anti-NDUFA10

Información del producto

Polyclonal Antibody against Human NDUFA10, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa, Alternative Gene Names: CI-42k, Validated applications: ICC, WB, Uniprot ID: O95299, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA10
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Immunogen SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CI-42k
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95299
HTS Code 3002150000
Gene ID 4705
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFA10 Antibody 100ul

Anti-NDUFA10 Antibody 100ul