ZNF713,FLJ39963
  • ZNF713,FLJ39963

Anti-ZNF713 Antibody 25ul

Ref: AN-HPA059425-25ul
Anti-ZNF713

Información del producto

Polyclonal Antibody against Human ZNF713, Gene description: zinc finger protein 713, Alternative Gene Names: FLJ39963, Validated applications: IHC, Uniprot ID: Q8N859, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF713
Gene Description zinc finger protein 713
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Immunogen LDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ39963
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N859
HTS Code 3002150000
Gene ID 349075
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF713 Antibody 25ul

Anti-ZNF713 Antibody 25ul