EID3,FLJ25832,NSE4B
  • EID3,FLJ25832,NSE4B

Anti-EID3 Antibody 25ul

Ref: AN-HPA059367-25ul
Anti-EID3

Información del producto

Polyclonal Antibody against Human EID3, Gene description: EP300 interacting inhibitor of differentiation 3, Alternative Gene Names: FLJ25832, NSE4B, NSMCE4B, Validated applications: ICC, IHC, Uniprot ID: Q8N140, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EID3
Gene Description EP300 interacting inhibitor of differentiation 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
Immunogen PDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25832, NSE4B, NSMCE4B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N140
HTS Code 3002150000
Gene ID 493861
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EID3 Antibody 25ul

Anti-EID3 Antibody 25ul