TM9SF1,HMP70,MP70
  • TM9SF1,HMP70,MP70

Anti-TM9SF1 Antibody 25ul

Ref: AN-HPA059249-25ul
Anti-TM9SF1

Información del producto

Polyclonal Antibody against Human TM9SF1, Gene description: transmembrane 9 superfamily member 1, Alternative Gene Names: HMP70, MP70, Validated applications: ICC, IHC, Uniprot ID: O15321, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TM9SF1
Gene Description transmembrane 9 superfamily member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
Immunogen RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HMP70, MP70
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15321
HTS Code 3002150000
Gene ID 10548
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TM9SF1 Antibody 25ul

Anti-TM9SF1 Antibody 25ul