N6AMT1,C21orf127
  • N6AMT1,C21orf127

Anti-N6AMT1 Antibody 25ul

Ref: AN-HPA059242-25ul
Anti-N6AMT1

Información del producto

Polyclonal Antibody against Human N6AMT1, Gene description: N-6 adenine-specific DNA methyltransferase 1 (putative), Alternative Gene Names: C21orf127, HEMK2, MTQ2, N6AMT, PRED28, Validated applications: ICC, Uniprot ID: Q9Y5N5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name N6AMT1
Gene Description N-6 adenine-specific DNA methyltransferase 1 (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Immunogen GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf127, HEMK2, MTQ2, N6AMT, PRED28
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5N5
HTS Code 3002150000
Gene ID 29104
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-N6AMT1 Antibody 25ul

Anti-N6AMT1 Antibody 25ul