ZNF362,FLJ25476
  • ZNF362,FLJ25476

Anti-ZNF362 Antibody 100ul

Ref: AN-HPA059239-100ul
Anti-ZNF362

Información del producto

Polyclonal Antibody against Human ZNF362, Gene description: zinc finger protein 362, Alternative Gene Names: FLJ25476, lin-29, RN, Validated applications: ICC, IHC, Uniprot ID: Q5T0B9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF362
Gene Description zinc finger protein 362
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR
Immunogen SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ25476, lin-29, RN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T0B9
HTS Code 3002150000
Gene ID 149076
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF362 Antibody 100ul

Anti-ZNF362 Antibody 100ul