PPIH,CYP-20,CYPH
  • PPIH,CYP-20,CYPH

Anti-PPIH Antibody 100ul

Ref: AN-HPA059019-100ul
Anti-PPIH

Información del producto

Polyclonal Antibody against Human PPIH, Gene description: peptidylprolyl isomerase H (cyclophilin H), Alternative Gene Names: CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP, Validated applications: IHC, WB, Uniprot ID: O43447, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPIH
Gene Description peptidylprolyl isomerase H (cyclophilin H)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Immunogen VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYP-20, CYPH, MGC5016, SnuCyp-20, USA-CYP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43447
HTS Code 3002150000
Gene ID 10465
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPIH Antibody 100ul

Anti-PPIH Antibody 100ul