PLXNA3,6.3,Plxn3
  • PLXNA3,6.3,Plxn3

Anti-PLXNA3 Antibody 25ul

Ref: AN-HPA058989-25ul
Anti-PLXNA3

Información del producto

Polyclonal Antibody against Human PLXNA3, Gene description: plexin A3, Alternative Gene Names: 6.3, Plxn3, PLXN4, SEX, XAP-6, Validated applications: ICC, WB, Uniprot ID: P51805, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PLXNA3
Gene Description plexin A3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Immunogen SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 6.3, Plxn3, PLXN4, SEX, XAP-6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51805
HTS Code 3002150000
Gene ID 55558
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLXNA3 Antibody 25ul

Anti-PLXNA3 Antibody 25ul