SMAD5,Dwfc,JV5-1
  • SMAD5,Dwfc,JV5-1

Anti-SMAD5 Antibody 100ul

Ref: AN-HPA058931-100ul
Anti-SMAD5

Información del producto

Polyclonal Antibody against Human SMAD5, Gene description: SMAD family member 5, Alternative Gene Names: Dwfc, JV5-1, MADH5, Validated applications: ICC, IHC, WB, Uniprot ID: Q99717, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMAD5
Gene Description SMAD family member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
Immunogen PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Dwfc, JV5-1, MADH5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99717
HTS Code 3002150000
Gene ID 4090
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMAD5 Antibody 100ul

Anti-SMAD5 Antibody 100ul