BMP2,BMP2A
  • BMP2,BMP2A

Anti-BMP2 Antibody 100ul

Ref: AN-HPA058610-100ul
Anti-BMP2

Información del producto

Polyclonal Antibody against Human BMP2, Gene description: bone morphogenetic protein 2, Alternative Gene Names: BMP2A, Validated applications: ICC, WB, Uniprot ID: P12643, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BMP2
Gene Description bone morphogenetic protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS
Immunogen RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BMP2A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P12643
HTS Code 3002150000
Gene ID 650
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BMP2 Antibody 100ul

Anti-BMP2 Antibody 100ul