DCPS,HINT-5,HSL1
  • DCPS,HINT-5,HSL1

Anti-DCPS Antibody 25ul

Ref: AN-HPA058597-25ul
Anti-DCPS

Información del producto

Polyclonal Antibody against Human DCPS, Gene description: decapping enzyme, scavenger, Alternative Gene Names: HINT-5, HSL1, HSPC015, Validated applications: ICC, Uniprot ID: Q96C86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DCPS
Gene Description decapping enzyme, scavenger
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY
Immunogen QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HINT-5, HSL1, HSPC015
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96C86
HTS Code 3002150000
Gene ID 28960
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DCPS Antibody 25ul

Anti-DCPS Antibody 25ul