USP35,KIAA1372
  • USP35,KIAA1372

Anti-USP35 Antibody 25ul

Ref: AN-HPA058592-25ul
Anti-USP35

Información del producto

Polyclonal Antibody against Human USP35, Gene description: ubiquitin specific peptidase 35, Alternative Gene Names: KIAA1372, Validated applications: IHC, Uniprot ID: Q9P2H5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name USP35
Gene Description ubiquitin specific peptidase 35
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
Immunogen LYLQEQEKEARSRAAYISALPTSPHWGRGFDEDKDEDEGSPGGCNPAGGNGGDFHRLVF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1372
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2H5
HTS Code 3002150000
Gene ID 57558
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USP35 Antibody 25ul

Anti-USP35 Antibody 25ul