DDB2,DDBB,FLJ34321
  • DDB2,DDBB,FLJ34321

Anti-DDB2 Antibody 25ul

Ref: AN-HPA058406-25ul
Anti-DDB2

Información del producto

Polyclonal Antibody against Human DDB2, Gene description: damage-specific DNA binding protein 2, 48kDa, Alternative Gene Names: DDBB, FLJ34321, UV-DDB2, Validated applications: ICC, IHC, Uniprot ID: Q92466, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DDB2
Gene Description damage-specific DNA binding protein 2, 48kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR
Immunogen GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DDBB, FLJ34321, UV-DDB2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92466
HTS Code 3002150000
Gene ID 1643
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DDB2 Antibody 25ul

Anti-DDB2 Antibody 25ul