UXT,ART-27,STAP1
  • UXT,ART-27,STAP1

Anti-UXT Antibody 25ul

Ref: AN-HPA058400-25ul
Anti-UXT

Información del producto

Polyclonal Antibody against Human UXT, Gene description: ubiquitously-expressed, prefoldin-like chaperone, Alternative Gene Names: ART-27, STAP1, Validated applications: ICC, IHC, Uniprot ID: Q9UBK9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UXT
Gene Description ubiquitously-expressed, prefoldin-like chaperone
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Immunogen LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ART-27, STAP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UBK9
HTS Code 3002150000
Gene ID 8409
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UXT Antibody 25ul

Anti-UXT Antibody 25ul