FUBP3,FBP3
  • FUBP3,FBP3

Anti-FUBP3 Antibody 100ul

Ref: AN-HPA058392-100ul
Anti-FUBP3

Información del producto

Polyclonal Antibody against Human FUBP3, Gene description: far upstream element (FUSE) binding protein 3, Alternative Gene Names: FBP3, Validated applications: ICC, WB, Uniprot ID: Q96I24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FUBP3
Gene Description far upstream element (FUSE) binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
Immunogen MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FBP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96I24
HTS Code 3002150000
Gene ID 8939
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FUBP3 Antibody 100ul

Anti-FUBP3 Antibody 100ul