RPL7,humL7-1,L7
  • RPL7,humL7-1,L7

Anti-RPL7 Antibody 100ul

Ref: AN-HPA058373-100ul
Anti-RPL7

Información del producto

Polyclonal Antibody against Human RPL7, Gene description: ribosomal protein L7, Alternative Gene Names: humL7-1, L7, Validated applications: ICC, IHC, WB, Uniprot ID: P18124, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPL7
Gene Description ribosomal protein L7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
Immunogen VEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names humL7-1, L7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18124
HTS Code 3002150000
Gene ID 6129
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPL7 Antibody 100ul

Anti-RPL7 Antibody 100ul