DHRS12,FLJ13639
  • DHRS12,FLJ13639

Anti-DHRS12 Antibody 100ul

Ref: AN-HPA058315-100ul
Anti-DHRS12

Información del producto

Polyclonal Antibody against Human DHRS12, Gene description: dehydrogenase/reductase (SDR family) member 12, Alternative Gene Names: FLJ13639, SDR40C1, Validated applications: ICC, Uniprot ID: A0PJE2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DHRS12
Gene Description dehydrogenase/reductase (SDR family) member 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence NLHVKTLSLMTWRSRFLEESFWSLEETAALAKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHKLHVLI
Immunogen NLHVKTLSLMTWRSRFLEESFWSLEETAALAKQLPLKSPSENIFLHIVDLSDPKQIWKFVENFKQEHKLHVLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13639, SDR40C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A0PJE2
HTS Code 3002150000
Gene ID 79758
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DHRS12 Antibody 100ul

Anti-DHRS12 Antibody 100ul