POU5F1B,OTF3C
  • POU5F1B,OTF3C

Anti-POU5F1B Antibody 100ul

Ref: AN-HPA058267-100ul
Anti-POU5F1B

Información del producto

Polyclonal Antibody against Human POU5F1B, Gene description: POU class 5 homeobox 1B, Alternative Gene Names: OTF3C, OTF3P1, POU5F1P1, Validated applications: ICC, Uniprot ID: Q06416, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POU5F1B
Gene Description POU class 5 homeobox 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Immunogen VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names OTF3C, OTF3P1, POU5F1P1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q06416
HTS Code 3002150000
Gene ID 5462
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POU5F1B Antibody 100ul

Anti-POU5F1B Antibody 100ul