TSPAN12,NET-2
  • TSPAN12,NET-2

Anti-TSPAN12 Antibody 100ul

Ref: AN-HPA058244-100ul
Anti-TSPAN12

Información del producto

Polyclonal Antibody against Human TSPAN12, Gene description: tetraspanin 12, Alternative Gene Names: NET-2, TM4SF12, Validated applications: IHC, WB, Uniprot ID: O95859, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSPAN12
Gene Description tetraspanin 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LMVPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMY
Immunogen LMVPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDSCCVREFPGCSKQAHQEDLSDLYQEGCGKKMY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NET-2, TM4SF12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95859
HTS Code 3002150000
Gene ID 23554
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPAN12 Antibody 100ul

Anti-TSPAN12 Antibody 100ul