C10orf128
  • C10orf128

Anti-C10orf128 Antibody 25ul

Ref: AN-HPA058166-25ul
Anti-C10orf128

Información del producto

Polyclonal Antibody against Human C10orf128, Gene description: chromosome 10 open reading frame 128, Alternative Gene Names: Em:AC084727.5, Validated applications: IHC, Uniprot ID: Q5T292, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C10orf128
Gene Description chromosome 10 open reading frame 128
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
Immunogen KICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRAHVLRD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Em:AC084727.5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T292
HTS Code 3002150000
Gene ID 170371
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C10orf128 Antibody 25ul

Anti-C10orf128 Antibody 25ul