AP1AR,2C18,C4orf16
  • AP1AR,2C18,C4orf16

Anti-AP1AR Antibody 100ul

Ref: AN-HPA058115-100ul
Anti-AP1AR

Información del producto

Polyclonal Antibody against Human AP1AR, Gene description: adaptor-related protein complex 1 associated regulatory protein, Alternative Gene Names: 2C18, C4orf16, gamma-BAR, PRO0971, Validated applications: ICC, Uniprot ID: Q63HQ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AP1AR
Gene Description adaptor-related protein complex 1 associated regulatory protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
Immunogen RIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRLSSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2C18, C4orf16, gamma-BAR, PRO0971
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q63HQ0
HTS Code 3002150000
Gene ID 55435
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AP1AR Antibody 100ul

Anti-AP1AR Antibody 100ul